PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21502.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 786aa    MW: 86469.4 Da    PI: 7.0019
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21502.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095936301954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  KHN21502.1 593 FEHflHPYPTDTDKHMLASQTGLSRNQVSNWFINARVR 630
                 665559******************************87 PP

2BELL99.52.7e-32439509272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 r + q kkakLl ++eeV ++ kqy+ q+q+v+ssFe vaglgsa+pY+ +Alk +S+hFrcLk+ i++q+
  KHN21502.1 439 RSDYQHKKAKLLYMQEEVSRQCKQYHLQMQMVVSSFESVAGLGSATPYIPMALKSVSKHFRCLKNSISDQL 509
                 6789****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.9E-42347507IPR006563POX domain
PfamPF075261.5E-40352506IPR006563POX domain
PROSITE profilePS5007112.001571634IPR001356Homeobox domain
SMARTSM003895.0E-9574638IPR001356Homeobox domain
CDDcd000866.75E-12574635No hitNo description
SuperFamilySSF466896.84E-17576640IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-27577638IPR009057Homeodomain-like
PfamPF059203.5E-18591630IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MSNLRPESHV AQQIRREKLR IQNSYQPSHE FPNNLEQLSL HPGFNNLDLV QVRNVRNANM  60
LDELAVYSSE MPNFSTSSSA ARNALEYHQE QGAAAEPSNR LLLMNQYGSF PHSMSAIHSS  120
HKQQCELRNL GNWRNSTPHQ GSDWFVNYAS NANSFLSAEL NNNVSAYNEL MDVHCSNASG  180
EISGREMHKQ GVLHHNSPPS SPLYQNALQD IVKSASFSAH TRQDMASLMQ QNEHSIWVGN  240
ASEAELQQPS YESQPNHELR FGWTNRTIAC DSLPQSLSLS LSSNAQPKPS VSHLEQGSAS  300
DDPQCLKHMK SIVSRDCGKS VQDQVEIPSK STTTITYRSV GPLGPFTGYA TILKSSRFLK  360
SAQQLLDEIC CLSDAKFGKS YDVSKRVSPE VSASTSADTV TGVAAKGSNS GSSSTTLYNV  420
SKENRADPGV GSSFGLSSRS DYQHKKAKLL YMQEEVSRQC KQYHLQMQMV VSSFESVAGL  480
GSATPYIPMA LKSVSKHFRC LKNSISDQLK LISEALGEDL SIPCSTSTCS NKADTTTMAR  540
VRCGSSMDQS FFLKNKCVKG TTELLDEPPQ QHVWRPQRGL PERAVAILKA WLFEHFLHPY  600
PTDTDKHMLA SQTGLSRNQV SNWFINARVR VWKPMVEEIH TLETKATGSK DNCGINEGTS  660
SATGGDTSHP RALGNIGLNS IPETQFQGID MGSSIAANAE ESGLNPEQWS QEKRSKLECQ  720
VTSTMDGTLM GFVPYRHGGV EVGGLGSVSL TLGLRHGVEG VQNQQQLQEE QLRHDVGGHM  780
IHEFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-15580637158Homeobox protein Meis1
4xrs_B1e-15580637158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594969.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_006594970.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_014621537.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0B2QP550.0A0A0B2QP55_GLYSO; BEL1-like homeodomain protein 8
STRINGGLYMA13G39901.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.16e-78BEL1-like homeodomain 8
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]